PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.WJS5F
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family G2-like
Protein Properties Length: 485aa    MW: 53030.9 Da    PI: 5.5481
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.WJS5FgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like109.71.5e-34260314155
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  kpr+rWtpeLHe+Fv+av+qLGGse+AtPk +l+lmkv+gLt++hvkSHLQkYR+
  Araip.WJS5F 260 KPRMRWTPELHEAFVDAVNQLGGSERATPKGVLKLMKVEGLTIYHVKSHLQKYRT 314
                  79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.169257317IPR017930Myb domain
SuperFamilySSF466894.48E-18258314IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.3E-32259316IPR009057Homeodomain-like
TIGRFAMsTIGR015578.4E-25260314IPR006447Myb domain, plants
PfamPF002498.0E-10262313IPR001005SANT/Myb domain
PfamPF143795.5E-24346391IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 485 aa     Download sequence    Send to blast
MEARPSISIE RSSAEELNVM GMSGVLSSSL AVLPTPLEET YNKLPDSPLA FVEEGLMSRP  60
LTHSGHLNNN GAVGHIFSSS PGYSTALHHS SLSPHEKHSR NAHIISHSST NMATLPPFSS  120
NSGPLPSKPS SHFPNENSAS WHTDSVPSFL DFPANTSIDS GRVESGACTI MTSEEYCKQN  180
DWQEWADQLI SDDDTLTSNL NDLLADNVPD PEPKEPFQVS KPSLQLPGHP SEGHQQLPAS  240
SEENCAGAAP SFSAKSAPSK PRMRWTPELH EAFVDAVNQL GGSERATPKG VLKLMKVEGL  300
TIYHVKSHLQ KYRTARYRPD SSEGVSEKKT SSIEEMSSLD LKTGIDITEA LRLQMVVQKQ  360
LHEQLEIQRN LQLRIEEQGR YLQMMFEKQC KPETEMFKAS LSTAENPSGS SLDAMQDVPA  420
KSASMVDSYK PGPDQAIGST TVVEGSVEIR GKHDSPKTQL SENPKQHANA NDDAAQASKR  480
QRKDE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016182990.10.0PREDICTED: protein PHR1-LIKE 1-like isoform X1
RefseqXP_016182991.10.0PREDICTED: protein PHR1-LIKE 1-like isoform X1
TrEMBLA0A0B2SXD80.0A0A0B2SXD8_GLYSO; Myb family transcription factor APL
TrEMBLK7LZC60.0K7LZC6_SOYBN; Uncharacterized protein
TrEMBLK7LZC80.0K7LZC8_SOYBN; Uncharacterized protein
STRINGGLYMA13G18805.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15123498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G29000.22e-86G2-like family protein